PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim07g007120.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family TALE
Protein Properties Length: 432aa    MW: 48015.7 Da    PI: 5.9628
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim07g007120.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox23.41e-073744072154
                         HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
            Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                         k +yp++e++++L +++gL+ +q+ +WF N+R +
  Sopim07g007120.0.1 374 KWPYPTEEDKARLVQETGLQLKQINNWFINQRKR 407
                         469*****************************87 PP

2ELK28.82.8e-10328349122
                 ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                         ELKh+L+++Y+++++++++E++
  Sopim07g007120.0.1 328 ELKHELKQGYKEKIVDIREEIL 349
                         9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012551.1E-19162206IPR005540KNOX1
PfamPF037903.9E-17164205IPR005540KNOX1
SMARTSM012566.4E-25215271IPR005541KNOX2
PfamPF037911.3E-18221270IPR005541KNOX2
PROSITE profilePS512139.969328348IPR005539ELK domain
SMARTSM011886.1E-4328349IPR005539ELK domain
PfamPF037891.0E-6328349IPR005539ELK domain
PROSITE profilePS5007111.726348411IPR001356Homeobox domain
SMARTSM003894.7E-11350415IPR001356Homeobox domain
SuperFamilySSF466895.13E-16350414IPR009057Homeodomain-like
CDDcd000863.41E-11351412No hitNo description
Gene3DG3DSA:1.10.10.603.1E-25355412IPR009057Homeodomain-like
PfamPF059201.2E-17368407IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 432 aa     Download sequence    Send to blast
MEFQDHFSQE MVLHQQQQQQ QQQQNAVLRS MLPESPHHDA RKSPPTWLNT SLLRQQHSQF  60
GNASSPSSAA AAAAVAGGNN FLHLQTSNSD SSNSNQWLSP TAAAGGGGNG GGGGHNDELS  120
ESMNFAKKMS QQHSGGGEEN NNNNNNNNNN NNNEEENSWE REKCKADILN HPLYDQLLSA  180
HVSCLRIATP VDQLPRIDAQ LAQSQNVVAK YSVLGQGQPP LDDKDLDQFM THYVLLLSSF  240
KEQLQQHVRV HAMEAVMACW ELEQSLQSLT GVAPGEGTGA TMSDDDDDQA DSDTNFLDGG  300
FDGPDSMGFG PLVPTESERS LMERVRQELK HELKQGYKEK IVDIREEILR KRRAGKLPGD  360
TTSVLKAWWQ SHSKWPYPTE EDKARLVQET GLQLKQINNW FINQRKRNWH SNPSTSSSQK  420
SKRKSAGEIK Q*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1x2n_A2e-12351415872Homeobox protein PKNOX1
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0142140.0BT014214.1 Lycopersicon esculentum clone 133392F, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001233945.20.0homeobox protein knotted-1-like LET12
SwissprotO223000.0LET12_SOLLC; Homeobox protein knotted-1-like LET12
TrEMBLK4CBI30.0K4CBI3_SOLLC; Uncharacterized protein
STRINGSolyc07g007120.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA14322472
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25220.11e-151KNOTTED1-like homeobox gene 3